Proteintech, 14219-1-AP, MTIF3 Polyclonal antibody

Size: 20ul / 150ul The MTIF3 (14219-1-AP) by Proteintech is a Polyclonal antibody targeting MTIF3 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 14219-1-AP targets MTIF3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, human preadipocyte cells, HT-29 cells, HeLa cells, HepG2 cells Positive IP detected in: HeLa cells Positive IHC detected in: human liver tissue, mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MTIF3, also named as DC38, belongs to the IF-3 family. MTIF3 encodes a 29 kDa protein that promotes formation of the initiation complex on the mitochondrial 55S ribosome, thereby playing an active role in initiation of translation. Like bacterial IF3, MTIF3 is believed to bind first to the small mitoribosomal subunit to keep it dissociated from the large subunit during initiation. After binding of MTIF3, mRNA and formylated initiator methionyl-tRNA (fMet-tRNAifMet) bind to the small mitoribosomal subunit. The large subunit then joins the small subunit to form an elongation-competent ribosome (PMID:20887776, 31350787). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5457 Product name: Recombinant human MTIF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-278 aa of BC046166 Sequence: MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKIKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ Predict reactive species Full Name: mitochondrial translational initiation factor 3 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC046166 Gene Symbol: MTIF3 Gene ID (NCBI): 219402 RRID: AB_10638621 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2K0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.