Iright
BRAND / VENDOR: Proteintech

Proteintech, 14221-1-AP, ACTN2 Polyclonal antibody

CATALOG NUMBER: 14221-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ACTN2 (14221-1-AP) by Proteintech is a Polyclonal antibody targeting ACTN2 in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples 14221-1-AP targets ACTN2 in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, C2C12 cells, mouse lung tissue, mouse skeletal muscle tissue, mouse heart, mouse kidney, rat skeletal muscle Positive IP detected in: HeLa cells Positive IHC detected in: mouse heart tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Positive IF-Fro detected in: mouse heart tissue Positive IF/ICC detected in: C2C12 cells, NIH/3T3 cells, Human iPSC derived cardiomyocyte Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Alpha actinin 2 (ACTN2) belongs to the alpha-actinin family and is expressed in both skeletal and cardiac muscles and functions to anchor myofibrillar actin thin filaments and titin to Z-discs (PMID: 30701273). ACTN2 is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. Mutations in ACTN2 are associated with hypertrophic cardiomyopathy, as well as dilated cardiomyopathy and endocardial fibroelastosis (PMID: 20022194, 14567970). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, canine, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5459 Product name: Recombinant human ACTN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC051770 Sequence: MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTI Predict reactive species Full Name: actinin, alpha 2 Calculated Molecular Weight: 104 kDa Observed Molecular Weight: 103 kDa GenBank Accession Number: BC051770 Gene Symbol: ACTN2 Gene ID (NCBI): 88 RRID: AB_2221547 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35609 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924