Proteintech, 14222-1-AP, ECEL1 Polyclonal antibody

Size: 20ul / 150ul The ECEL1 (14222-1-AP) by Proteintech is a Polyclonal antibody targeting ECEL1 in ELISA applications with reactivity to human, mouse, rat samples 14222-1-AP targets ECEL1 in ELISA applications and shows reactivity with human, mouse, rat samples. Background Information The M13 family has seven members, including ECEL1 (endothelin-converting enzyme-like 1), one of the newest members. ECEL1 is expressed predominantly in the central nervous system. It has been proposed that the enzyme has a role in the nervous regulation of the respiratory system(PMID:14992683).It may contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.It has 2 isoforms produced by alternative splicing and 3 glycosylation sites.It can be detected a band of 95kDa in CHO cells by western blot because of the heavily glycosylated(PMID:10961933). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5460 Product name: Recombinant human ECEL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 425-775 aa of BC050453 Sequence: AQEMEGSDKPQELARVCLGQANRHFGMALGALFVHEHFSAASKAKVQQLVEDIKYILGQRLEELDWMDAETRAAARAKLQYMMVMVGYPDFLLKPDAVDKEYEFEVHEKTYFKNILNSIRFSIQLSVKKIRQEVDKSTWLLPPQALNAYYLPNKNQMVFPAGILQPTLYDPDFPQSLNYGGIGTIIGHELTHGYDDWGGQYDRSGNLLHWWTEASYSRFLRKAECIVRLYDNFTVYNQRVNGKHTLGENIADMGGLKLAYHAYQKWVREHGPEHPLPRLKYTHDQLFFIAFAQNWCIKRRSQSIYLQVLTDKHAPEHYRVLGSVSQFEEFGRAFHCPKDSPMNPAHKCSVW Predict reactive species Full Name: endothelin converting enzyme-like 1 Calculated Molecular Weight: 88 kDa GenBank Accession Number: BC050453 Gene Symbol: ECEL1 Gene ID (NCBI): 9427 RRID: AB_2097867 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95672 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.