Iright
BRAND / VENDOR: Proteintech

Proteintech, 14244-1-AP, MMP19 Polyclonal antibody

CATALOG NUMBER: 14244-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MMP19 (14244-1-AP) by Proteintech is a Polyclonal antibody targeting MMP19 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 14244-1-AP targets MMP19 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells, human placenta tissue Positive IP detected in: human placenta tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MMP19(matrix metalloproteinase-19) has the capacity to degrade several basement membrane proteins such as type IV collagen, laminin, tenascin C, and nidogen. It is expressed by microvascular endothelial cells in vitro as well as by capillaries in the inflamed synovial membrane, whereas its expression is absent in quiescent macrovascular endothelial cells of large arteries and veins . And it is also detected in capillaries of normal mammary tissue, benign mammary carcinomas and in skin capillaries(PMID:15241558). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5501 Product name: Recombinant human MMP19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-508 aa of BC050368 Sequence: RIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY Predict reactive species Full Name: matrix metallopeptidase 19 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 57-60 kDa GenBank Accession Number: BC050368 Gene Symbol: MMP19 Gene ID (NCBI): 4327 RRID: AB_10637857 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99542 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924