Proteintech, 14249-1-AP, MYL5 Polyclonal antibody

Size: 20ul / 150ul The MYL5 (14249-1-AP) by Proteintech is a Polyclonal antibody targeting MYL5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14249-1-AP targets MYL5 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, human brain tissue, rat skeletal muscle tissue Positive IHC detected in: human cervical cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5522 Product name: Recombinant human MYL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC040050 Sequence: MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE Predict reactive species Full Name: myosin, light chain 5, regulatory Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC040050 Gene Symbol: MYL5 Gene ID (NCBI): 4636 RRID: AB_2266762 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02045 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.