Proteintech, 14260-1-AP, CNIH2 Polyclonal antibody

Size: 20ul / 150ul The CNIH2 (14260-1-AP) by Proteintech is a Polyclonal antibody targeting CNIH2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 14260-1-AP targets CNIH2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: fetal human brain tissue, Rat brain tissue, Mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CNIH2, or cornichon family AMPA receptor auxiliary protein 2, is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype.CNIH2 has been reported to interact with the Type I AMPA Receptor regulatory protein isoform gamma-8, which controls the assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. It has been implicated in various diseases, including schizophrenia, as indicated by its association with different schizophrenia-related disorders. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5533 Product name: Recombinant human CNIH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC047953 Sequence: MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWC Predict reactive species Full Name: cornichon homolog 2 (Drosophila) Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC047953 Gene Symbol: CNIH2 Gene ID (NCBI): 254263 RRID: AB_3669181 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PI25 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.