Iright
BRAND / VENDOR: Proteintech

Proteintech, 14272-1-AP, VPS4A Polyclonal antibody

CATALOG NUMBER: 14272-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VPS4A (14272-1-AP) by Proteintech is a Polyclonal antibody targeting VPS4A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14272-1-AP targets VPS4A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U-937 cells, SMMC-7721 cells, HepG2 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Vacuolar Protein Sorting 4A (VPS4A) is one of two human homologs of the yeast protein Vps4 and member of the AAA protein family (ATPases associated with diverse cellular activities). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5592 Product name: Recombinant human VPS4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 86-437 aa of BC047932 Sequence: KENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENESEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDFGQES Predict reactive species Full Name: vacuolar protein sorting 4 homolog A (S. cerevisiae) Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 48-55 kDa GenBank Accession Number: BC047932 Gene Symbol: VPS4A Gene ID (NCBI): 27183 RRID: AB_2878039 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UN37 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924