Iright
BRAND / VENDOR: Proteintech

Proteintech, 14291-1-AP, Renin Polyclonal antibody

CATALOG NUMBER: 14291-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Renin (14291-1-AP) by Proteintech is a Polyclonal antibody targeting Renin in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 14291-1-AP targets Renin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HepG2 cells Positive IHC detected in: human kidney tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information REN(Renin) is also named as angiotensinogenase and belongs to the peptidase A1 family. It is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. Human prorenin and renin are synthesized in juxtaglomerular cells and it locates in the juxtaglomerular cells and afferent arteriole as cytoplasmic granules (PMID:19664745, 9453303). REN has 2 isoforms produced by alternative splicing with the molecular weight of 45-47kDa. The mature REN can be detected as 38-42 kDa due to the cleavage of signal peptide and propeptide, and also detected as 55-60 kDa with variable degrees of glycosylation (PMID: 20966072, 15226276).Defects in REN are a cause of renal tubular dysgenesis (RTD) and familial juvenile hyperuricemic nephropathy type 2 (HNFJ2). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5612 Product name: Recombinant human REN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-406 aa of BC047752 Sequence: MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR Predict reactive species Full Name: renin Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC047752 Gene Symbol: Renin Gene ID (NCBI): 5972 RRID: AB_10695894 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00797 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924