Proteintech, 14304-1-AP, ACK1 Polyclonal antibody

Size: 20ul / 150ul The ACK1 (14304-1-AP) by Proteintech is a Polyclonal antibody targeting ACK1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14304-1-AP targets ACK1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HepG2 cells, HT-1080 cells, A431 cells, mouse brain tissue, HeLa cells, A549 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TNK2, also named ACK1, belongs to the protein kinase superfamily and Tyr protein kinase family. It is a non-receptor tyrosine-protein and serine/threonine-protein kinase that is implicated in cell spreading and migration, cell survival, and cell proliferation. TNK2 transduces extracellular signals to cytosolic and nuclear effectors. It is a downstream effector of CDC42 which mediates CDC42-dependent cell migration via phosphorylation of BCAR1. TNK2 confers metastatic properties on cancer cells by negatively regulating tumor suppressors such as WWOX and positively regulating pro-survival factors such as AKT1 and AR. The 60-70kd band is the isoform 2 of TNK2. Isoform 1 and 3 is about 120-125kd. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5419 Product name: Recombinant human ACK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-385 aa of BC028164 Sequence: MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFL Predict reactive species Full Name: tyrosine kinase, non-receptor, 2 Calculated Molecular Weight: 115 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC028164 Gene Symbol: TNK2 Gene ID (NCBI): 10188 RRID: AB_11041713 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q07912 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.