Proteintech, 14329-1-AP, TSPAN33 Polyclonal antibody

Size: 20ul / 150ul The TSPAN33 (14329-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN33 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14329-1-AP targets TSPAN33 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, human plasma tissue Positive IHC detected in: human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TSPAN33 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN33 belongs to the TSPANC8 subfamily, which also include TSPAN5, TSPAN10, TSPAN14, TSPAN15, and TSPAN17. It has been reported that TSPANC8 tetraspanins interact with ADAM10 and have a conserved function in the regulation of ADAM10 trafficking and activity, thereby positively regulating Notch receptor activation (PMID: 23091066; 23035126). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5597 Product name: Recombinant human TSPAN33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 116-236 aa of BC044244 Sequence: FVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNL Predict reactive species Full Name: tetraspanin 33 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 64-72 kDa GenBank Accession Number: BC044244 Gene Symbol: TSPAN33 Gene ID (NCBI): 340348 RRID: AB_10644331 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UF1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.