Iright
BRAND / VENDOR: Proteintech

Proteintech, 14335-1-AP, CADM1 Polyclonal antibody

CATALOG NUMBER: 14335-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CADM1 (14335-1-AP) by Proteintech is a Polyclonal antibody targeting CADM1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14335-1-AP targets CADM1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, A549 cells, human placenta tissue, mouse lung tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CADM1 (cell adhesion molecule 1), also referred to as SgIGSF, Necl-2 or TSLC-1, is a cell adhesion molecule belonging to the immunoglobulin superfamily. It can mediate homophilic and heterophilic cell-cell adhesion. CADM1 is expressed by a variety of cells including neurons, mast cells, spermatogonia, pancreatic islet cells, epithelial cells such as lung alveolar cells and biliary epithelial cells. CADM1 is involved in carcinoma pathogenesis and the expression of CADM1 is frequently down-regulated in various tumors derived from epithelial cells. It acts as a tumor suppressor in non-small-cell lung cancer (NSCLC) cells. (PMID: 18332875; 17326163; 20340131) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5621 Product name: Recombinant human CADM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-334 aa of BC047021 Sequence: DGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDSR Predict reactive species Full Name: cell adhesion molecule 1 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49-60 kDa GenBank Accession Number: BC047021 Gene Symbol: CADM1 Gene ID (NCBI): 23705 RRID: AB_2243801 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BY67 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924