Proteintech, 14340-1-AP, PALB2 Polyclonal antibody

Size: 20ul / 150ul The PALB2 (14340-1-AP) by Proteintech is a Polyclonal antibody targeting PALB2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14340-1-AP targets PALB2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, THP-1 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PALB2 can interact with BRCA1 and BRCA2 and form the BRCA1-PALB2-BRCA2 complex which is critical for homologous recombination and DNA damage response. PALB2 is an essential partner of BRCA2 that promotes the localization and stability of BRCA2. The predicted MW of PALB2 is approximately 130 kDa, while the truncated PALB2 protein arround 80-90 kDa can also be detected in SDS-PAGE similar to papers. (PubMed:16793542, 24141787, 24153426). There's the dimer form with MW 250-260 kDa (refer to PMID: 30289697). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5654 Product name: Recombinant human PALB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 841-1186 aa of BC044254 Sequence: TAELPASDSINPGNLQLVSELKNPSGSCSVDVSAMFWERAGCKEPCIITACEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCSSDDESEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQFLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLLFIVLSHPCAKESESLRSPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHCAAAILTSGTIAIWDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS Predict reactive species Full Name: partner and localizer of BRCA2 Calculated Molecular Weight: 131 kDa Observed Molecular Weight: 130 kDa; 80-90 kDa; 250-260 kDa GenBank Accession Number: BC044254 Gene Symbol: PALB2 Gene ID (NCBI): 79728 RRID: AB_2158774 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86YC2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.