Proteintech, 14348-1-AP, CRCP Polyclonal antibody

Size: 20ul / 150ul The CRCP (14348-1-AP) by Proteintech is a Polyclonal antibody targeting CRCP in WB, IHC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 14348-1-AP targets CRCP in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, HeLa cells, human testis tissue, MCF-7 cells Positive IP detected in: Raji cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Positive FC (Intra) detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5689 Product name: Recombinant human CRCP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC040107 Sequence: MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA Predict reactive species Full Name: CGRP receptor component Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC040107 Gene Symbol: CRCP Gene ID (NCBI): 27297 RRID: AB_10641051 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75575 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.