Iright
BRAND / VENDOR: Proteintech

Proteintech, 14352-1-AP, RBP3 Polyclonal antibody

CATALOG NUMBER: 14352-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RBP3 (14352-1-AP) by Proteintech is a Polyclonal antibody targeting RBP3 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 14352-1-AP targets RBP3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, Y79 cells Positive IP detected in: Y79 cells Positive IHC detected in: human eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information RBP3 (retinoid-binding protein 3), also called interstitial retinoid-binding protein (IRBP), is a large glycoprotein that is synthesized and secreted by rod photoreceptor cells into the interphotoreceptor matrix. It is known to bind retinoids and fatty acids. RBP3 migrates around 136-140 kDa in the western blot analysis. (PMID: 15928609) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5699 Product name: Recombinant human RBP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 898-1247 aa of BC039844 Sequence: AMSATTGKAWDLAGVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIPSPEVFEELIKFSFHTNVLEDNIGYLRFDMFGDGELLTQVSRLLVEHIWKKIMHTDAMIIDMRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVSELWTHAQVVGERYGSKKSMVILTSSVTAGTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDHL Predict reactive species Full Name: retinol binding protein 3, interstitial Calculated Molecular Weight: 135 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC039844 Gene Symbol: RBP3 Gene ID (NCBI): 5949 RRID: AB_2096956 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10745 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924