Iright
BRAND / VENDOR: Proteintech

Proteintech, 14360-1-AP, RBM6 Polyclonal antibody

CATALOG NUMBER: 14360-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RBM6 (14360-1-AP) by Proteintech is a Polyclonal antibody targeting RBM6 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14360-1-AP targets RBM6 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse spleen tissue Positive IP detected in: HeLa cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RBM6, also named as DEF3, is a 1123 amino acid protein, which may interact with FAM168B. RBM6 is expressed ubiquitously in adults tissues. RBM6 specifically binds poly(G) RNA homopolymers in vitro. RBM6 exists some isoforms with MV 129 kDa, 69 kDa, and 59 kDa. onversely, fetal thymus and adult kidney express very little RBM6. In the hemopoietic system of mice, the expression of RBM6 is downregulated upon differentiation of progenitor cells into granulocytes but persists during macrophage development. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5743 Product name: Recombinant human RBM6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-601 aa of BC046643 Sequence: LPEEEEIKEKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVNPLIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLHKQNLEIHRKIKQSEQELAYLERREREGKFKGRGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD Predict reactive species Full Name: RNA binding motif protein 6 Calculated Molecular Weight: 129 kDa Observed Molecular Weight: 129 kDa GenBank Accession Number: BC046643 Gene Symbol: RBM6 Gene ID (NCBI): 10180 RRID: AB_2301175 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P78332 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924