Iright
BRAND / VENDOR: Proteintech

Proteintech, 14361-1-AP, Adiponectin receptor Polyclonal antibody

CATALOG NUMBER: 14361-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Adiponectin receptor (14361-1-AP) by Proteintech is a Polyclonal antibody targeting Adiponectin receptor in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 14361-1-AP targets Adiponectin receptor in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, human placenta tissue, rat liver tissue, L02 cells Positive IP detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Adiponectin is a hormone secreted by adipocytes that acts as an antidiabetic and anti-atherogenic adipokine. Two receptors for adiponectin (ADIPOR1 and ADIPOR2) have been identified. They mediate increased AMPK, MAPK, and PPARA ligand activity in response to adiponectin. AdipoR1 is abundantly expressed in skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver. The human ADIPOR2 gene maps to chromosome 12p13.31, and encodes a 386-amino acid protein with a molecular weight of 44 kDa. AdipoR2 may also exist as stable ~ 60 kDa dimers (PMID: 18842004). This antibody raised against 1-147aa of human AdipoR2 may cross-react with AdipoR1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5744 Product name: Recombinant human ADIPOR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC051858 Sequence: MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG Predict reactive species Full Name: adiponectin receptor 2 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 44 kDa, 60 kDa GenBank Accession Number: BC051858 Gene Symbol: Adiponectin receptor Gene ID (NCBI): 79602 RRID: AB_2222052 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86V24 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924