Proteintech, 14373-1-AP, NTM Polyclonal antibody

Size: 20ul / 150ul The NTM (14373-1-AP) by Proteintech is a Polyclonal antibody targeting NTM in WB, IHC, ELISA applications with reactivity to human, mouse samples 14373-1-AP targets NTM in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Neurotrimin (NTM) is a glycosylphosphatidylinositol (GPI)-anchored neural cell adhesion molecule. Neurotrimin together with the limbic system-associated protein (LAMP) and the opioid binding cell adhesion molecule (OBCAM) comprise the IgLON family of the immunoglobulin superfamily. Neurotrimin may be promoting neurite outgrowth and adhesion via a homophilic mechanism. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5746 Product name: Recombinant human NTM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-316 aa of BC050716 Sequence: VCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFGETVL Predict reactive species Full Name: neurotrimin Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 58 kDa, 65 kDa GenBank Accession Number: BC050716 Gene Symbol: NTM Gene ID (NCBI): 50863 RRID: AB_2878048 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P121 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.