Iright
BRAND / VENDOR: Proteintech

Proteintech, 14396-1-AP, PASK Polyclonal antibody

CATALOG NUMBER: 14396-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PASK (14396-1-AP) by Proteintech is a Polyclonal antibody targeting PASK in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14396-1-AP targets PASK in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells, Jurkat cells Positive IP detected in: K-562 cells Positive IHC detected in: mouse testis tissue, human prostate hyperplasia tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information PAS (Per-Arnt-Sim) domains regulate the function of many intracellular signaling pathways in response to both extrinsic and intrinsic stimuli. PAS domain-containing serine/threonine-protein kinase (PASK, also termed PAS-kinase or PASKIN) is an evolutionarily conserved nutrient responsive protein kinase. PASK links energy flux and protein synthesis in yeast and regulates glycogen synthesis in mammals. It has also been implicated in glucose-stimulated INS production in pancreatic beta-cells. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5893 Product name: Recombinant human PASK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 999-1323 aa of BC063585 Sequence: YSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRLLTS Predict reactive species Full Name: PAS domain containing serine/threonine kinase Calculated Molecular Weight: 143 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: BC063585 Gene Symbol: PASK Gene ID (NCBI): 23178 RRID: AB_2878053 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96RG2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924