Iright
BRAND / VENDOR: Proteintech

Proteintech, 14416-1-AP, MOCS2B Polyclonal antibody

CATALOG NUMBER: 14416-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MOCS2B (14416-1-AP) by Proteintech is a Polyclonal antibody targeting MOCS2B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14416-1-AP targets MOCS2B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse heart tissue, Jurkat cells Positive IHC detected in: rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information MOCS2(Molybdenum cofactor synthesis 2) is a heterotetrameric synthase comprised of 2 small (MOCS2A) and 2 large (MOCS2B) subunits. MOCS2 acts as a sulfur carrier required for molybdopterin biosynthesis. The two MOCS2 proteins A and B are subunits of molybdopterin synthase incorporating sulfur groups delivered by the MOCS3 sulfurylase. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5761 Product name: Recombinant human MOCS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-188 aa of BC046097 Sequence: MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS Predict reactive species Full Name: molybdenum cofactor synthesis 2 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC046097 Gene Symbol: MOCS2 Gene ID (NCBI): 4338 RRID: AB_2250779 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O96007 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924