Proteintech, 14427-1-AP, Apolipoprotein AI Polyclonal antibody

Size: 20ul / 150ul The Apolipoprotein AI (14427-1-AP) by Proteintech is a Polyclonal antibody targeting Apolipoprotein AI in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse samples 14427-1-AP targets Apolipoprotein AI in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human blood tissue, human brain tissue, human plasma, human ileum tissue Positive IHC detected in: human liver cancer tissue, human liver tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information ApoA1 is a major protein component of high density lipoproteins (HDL) which is associated with reversed cholesterol transport, lipid/cholesterol binding, lecithin/cholesterol acyltransferase (LCAT) activation and specific receptors binding. It is synthesized in the liver and small intestine. Defects of ApoA1 cause low HDL level and systemic non-neuropathic amyloidosis. Serum concentration of ApoA1 is inversely related to the risk of developing atherosclerosis. This antibody was generated against the C-terminal region of human ApoA1. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5793 Product name: Recombinant human APOA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-267 aa of BC005380 Sequence: RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ Predict reactive species Full Name: apolipoprotein A-I Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC005380 Gene Symbol: APOA1 Gene ID (NCBI): 335 RRID: AB_2056524 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02647 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.