Iright
BRAND / VENDOR: Proteintech

Proteintech, 14446-1-AP, RSK3 Polyclonal antibody

CATALOG NUMBER: 14446-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RSK3 (14446-1-AP) by Proteintech is a Polyclonal antibody targeting RSK3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14446-1-AP targets RSK3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HeLa cells, MCF-7 cells, MDA-MB-231 cells Positive IP detected in: HeLa cells Positive IHC detected in: human lung cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RSK3, also named as RPS6KA2, belongs to the protein kinase superfamily. RSK3 is a serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of transcription factors, regulates translation, and mediates cellular proliferation, survival, and differentiation. In addition RSK3 may function as tumor suppressor in epithelial ovarian cancer cells(Uniprot). The molecular weight of RSK3 is 83 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5862 Product name: Recombinant human RPS6KA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 66-311 aa of BC002363 Sequence: GQGSYGKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSGEAQSLLRALFKRNPCNRLGAGIDGVEE Predict reactive species Full Name: ribosomal protein S6 kinase, 90kDa, polypeptide 2 Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 83 kDa GenBank Accession Number: BC002363 Gene Symbol: RSK3 Gene ID (NCBI): 6196 RRID: AB_2285316 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15349 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924