Iright
BRAND / VENDOR: Proteintech

Proteintech, 14466-1-AP, FECH Polyclonal antibody

CATALOG NUMBER: 14466-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FECH (14466-1-AP) by Proteintech is a Polyclonal antibody targeting FECH in WB, IHC, ELISA applications with reactivity to human, mouse samples 14466-1-AP targets FECH in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, HepG2 cells, human heart tissue, human liver tissue, K-562 cells, mouse kidney tissue, mouse liver tissue, rat heart tissue, rat liver tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information FECH(ferrochelatase, mitochondrial ) is also named as heme synthase, protoheme ferro-lyase and belongs to the ferrochelatase family. It is a homodimeric (86 kDa) mitochondrial membrane-associated enzyme that catalyzes the insertion of ferrous iron into protoporphyrin to form heme(PMID:11175906). It has 2 isoforms produced by alternative splicing and the full length protein has a transit peptide with 54 amino acids. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5814 Product name: Recombinant human FECH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-423 aa of BC039841 Sequence: VQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL Predict reactive species Full Name: ferrochelatase (protoporphyria) Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 40-48 kDa GenBank Accession Number: BC039841 Gene Symbol: FECH Gene ID (NCBI): 2235 RRID: AB_2231579 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924