Proteintech, 14471-1-AP, SLC32A1/VGAT Polyclonal antibody

Size: 20ul / 150ul The SLC32A1/VGAT (14471-1-AP) by Proteintech is a Polyclonal antibody targeting SLC32A1/VGAT in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples 14471-1-AP targets SLC32A1/VGAT in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: unboiled mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue, mouse brain tissue Positive IF-Fro detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information SLC32A1, also known as VGAT (vesicular GABA transporter), functions in the uptake of GABA and glycine into synaptic vesicles. GABA (gamma-aminobutyric acid), is the major inhibitory neurotransmitter in the CNS. VGAT transports GABA and glycine into acidic vesicles and localizes to the synaptic vesicle in glycinergic and GABAergic neurons. And VGAT antibodies are useful markers for presynaptic GABAergic and glycinergic neurons. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, caenorhabditis elegans Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5843 Product name: Recombinant human SLC32A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC053582 Sequence: MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWEAGWN Predict reactive species Full Name: solute carrier family 32 (GABA vesicular transporter), member 1 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC053582 Gene Symbol: VGAT Gene ID (NCBI): 140679 RRID: AB_10644324 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H598 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.