Product Description
Size: 20ul / 150ul
The DBI (14490-1-AP) by Proteintech is a Polyclonal antibody targeting DBI in WB, ELISA applications with reactivity to human, mouse, rat samples
14490-1-AP targets DBI in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: U-87 MG cells, human liver tissue
Recommended dilution
Western Blot (WB): WB : 1:300-1:600
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag5891 Product name: Recombinant human DBI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC062996 Sequence: MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKY Predict reactive species
Full Name: diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein)
Calculated Molecular Weight: 10 kDa
Observed Molecular Weight: 10 kDa
GenBank Accession Number: BC062996
Gene Symbol: ACBP/DBI
Gene ID (NCBI): 1622
RRID: AB_2211037
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P07108
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924