Proteintech, 14500-1-AP, PRM2 Polyclonal antibody

Size: 20ul / 150ul The PRM2 (14500-1-AP) by Proteintech is a Polyclonal antibody targeting PRM2 in WB, IHC, ELISA applications with reactivity to human samples 14500-1-AP targets PRM2 in WB, IHC, ELISA, IF applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information PRM2 (Protamine-2) is the main DNA-binding protein in the sperm nucleus, consisting of a C-terminal mature PRM2 (mPRM2) domain and an N-terminal lytic PRM2 (cPRM2) domain, which is lyzed sequentially after binding to DNA. PRM2 plays an important role in spermatogenesis and development. PRM2 is specifically expressed in sperm and localized in the sperm nucleus. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5952 Product name: Recombinant human PRM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC066338 Sequence: MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH Predict reactive species Full Name: protamine 2 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 10-25 kDa GenBank Accession Number: BC066338 Gene Symbol: PRM2 Gene ID (NCBI): 5620 RRID: AB_2721024 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04554 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.