Iright
BRAND / VENDOR: Proteintech

Proteintech, 14504-1-AP, CROP Polyclonal antibody

CATALOG NUMBER: 14504-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CROP (14504-1-AP) by Proteintech is a Polyclonal antibody targeting CROP in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 14504-1-AP targets CROP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HepG2 cells, mouse brain tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human ovary cancer tissue, human ovary tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CROP, a putative SR protein, contain cystine/histidine motifs and leucine zipper-like repeats in the N-terminal half and consists mostly of charged and polar amino acids in the C-terminal half. CROP has a high expression in heart, brain, pancreas, thymus, and weak in lung, live and kidney. As the human homologue of yeast Luc7p, CROP is supported to be participated in 5'-splice site recognize and is essential for vegetative growth. This is a rabbit polyclonal antibody raised against part of N-terminus of CROP of human origin, and can recognize a ~58kDa band of CROP. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5961 Product name: Recombinant human CROP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC056409 Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE Predict reactive species Full Name: cisplatin resistance-associated overexpressed protein Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 55-58 kDa GenBank Accession Number: BC056409 Gene Symbol: CROP Gene ID (NCBI): 51747 RRID: AB_2229967 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95232 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924