Proteintech, 14509-1-AP, UBL4B Polyclonal antibody

Size: 20ul / 150ul The UBL4B (14509-1-AP) by Proteintech is a Polyclonal antibody targeting UBL4B in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14509-1-AP targets UBL4B in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue Positive IF/ICC detected in: HepG2 cells, Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5968 Product name: Recombinant human UBL4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-174 aa of BC058929 Sequence: MFLTVKLLLGQRCSLKVSGQESVATLKRLVSRRLKVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEPQDAKAVLQLLRQEHEERLQKISLEHLEQLAQYLLAEEPHVEPAGERELEAKARPQSSCDMEEKEEAAADQ Predict reactive species Full Name: ubiquitin-like 4B Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC058929 Gene Symbol: UBL4B Gene ID (NCBI): 164153 RRID: AB_10640905 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N7F7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.