Iright
BRAND / VENDOR: Proteintech

Proteintech, 14511-1-AP, Synaptotagmin-1 Polyclonal antibody

CATALOG NUMBER: 14511-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Synaptotagmin-1 (14511-1-AP) by Proteintech is a Polyclonal antibody targeting Synaptotagmin-1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 14511-1-AP targets Synaptotagmin-1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, HCT 116 cells, mouse testis tissue, human liver tissue, Y79 cells Positive IP detected in: mouse cerebellum tissue, HCT 116 cells Positive IHC detected in: rat small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HCT 116 cells Recommended dilution Western Blot (WB): WB : 1:4000-1:20000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). SYT1 (synaptotagmin I) was firstly identified as a 65-kDa protein with a wide distribution in neuronal and neurosecretory tissue (PMID: 7298720). Calcium binding to SYT1 participates in triggering neurotransmitter release at the synapse (PMID: 11242035). In addition to regulating exocytosis, SYT1 has also been implicated in endocytosis and neurite outgrowth (PMID: 15492212; 11078930; 10336114). This antibody recognizes endogenous SYT1, which has an experimentally determined molecular mass of 65-68 kDa. An additional band of 47 kDa could also be detected, which is corresponding to the calculated molecular weight of SYT1. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5970 Product name: Recombinant human SYT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-422 aa of BC058917 Sequence: GGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK Predict reactive species Full Name: synaptotagmin I Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 65 kDa, 47 kDa GenBank Accession Number: BC058917 Gene Symbol: Synaptotagmin-1 Gene ID (NCBI): 6857 RRID: AB_2199166 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21579 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924