Proteintech, 14517-1-AP, USP14 Polyclonal antibody

Size: 20ul / 150ul The USP14 (14517-1-AP) by Proteintech is a Polyclonal antibody targeting USP14 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14517-1-AP targets USP14 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: DU 145 cells, HeLa cells, mouse heart tissue, HEK-293T cells, HEK-293 cells, SKOV-3 cells, Neuro-2a cells Positive IP detected in: mouse liver tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:18000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information USP14(Ubiquitin carboxyl-terminal hydrolase 14) is also named as TGT and belongs to the peptidase C19 family. Mammalian USP14 is unique among known UBP enzymes in that it is activated catalytically upon specific association with the 26S proteasome. USP14 inhibition accelerated the degradation of oxidized proteins and enhanced resistance to oxidative stress.This protein has a 45-kDa catalytic domain (PMID:16211010). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5979 Product name: Recombinant human USP14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-294 aa of BC003556 Sequence: MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRL Predict reactive species Full Name: ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 52-60 kDa GenBank Accession Number: BC003556 Gene Symbol: USP14 Gene ID (NCBI): 9097 RRID: AB_2257124 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P54578 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.