Iright
BRAND / VENDOR: Proteintech

Proteintech, 14543-1-AP, LZIC Polyclonal antibody

CATALOG NUMBER: 14543-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LZIC (14543-1-AP) by Proteintech is a Polyclonal antibody targeting LZIC in WB, ELISA applications with reactivity to human samples 14543-1-AP targets LZIC in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells, HepG2 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information LZIC is closely related to ICAT, a physiological inhibitor of the Wnt pathway that interacts physically and functionally with β-catenin to prevent the transcription of Wnt target genes. LZIC's ICAT-homologous region is highly similar to ICAT with particular conservation of residues that are used by ICAT for β-catenin-binding. LZIC does not interact with β-catenin in vitro or in vivo. LZIC is a protein conserved in vertebrates, is required for neuronal survival. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6047 Product name: Recombinant human LZIC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC063443 Sequence: MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK Predict reactive species Full Name: leucine zipper and CTNNBIP1 domain containing Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21-24 kDa GenBank Accession Number: BC063443 Gene Symbol: LZIC Gene ID (NCBI): 84328 RRID: AB_2138923 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WZA0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924