Iright
BRAND / VENDOR: Proteintech

Proteintech, 14550-1-AP, AFP Polyclonal antibody

CATALOG NUMBER: 14550-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AFP (14550-1-AP) by Proteintech is a Polyclonal antibody targeting AFP in WB, IHC, IP, ELISA applications with reactivity to human samples 14550-1-AP targets AFP in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells, HepG2 cells, HuH-7 cells, L02 cells, HepG2cells, human placenta tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human ovary cancer tissue, human liver cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information AFP (Alpha-fetoprotein) is a major plasma protein in the fetus and its concentration is very low in the adult (PMID:24120489). AFP can be detected at abnormally high concentrations in hepatocellular carcinomas as well as in the plasma and ascitic fluid of adults with hepatoma, indicating that AFP can serve as a tumor marker (PMID: 18669658). AFP is also a glycosylated protein and based on its binding capability to lectin Lens Culinaris Agglutinin (LCA), and total AFP can be separated into three different glycoforms, AFP-L1, AFP-L2, and AFP-L3. Core-fucosylated form of AFP (AFP-L3) is a more specific indicator than total AFP for HCC (PMID: 33128033, 35458505) Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6089 Product name: Recombinant human AFP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 260-609 aa of BC027881 Sequence: LDVAHVHEHCCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV Predict reactive species Full Name: alpha-fetoprotein Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 68-72 kDa GenBank Accession Number: BC027881 Gene Symbol: AFP Gene ID (NCBI): 174 RRID: AB_2223933 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02771 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924