Iright
BRAND / VENDOR: Proteintech

Proteintech, 14560-1-AP, DHRS9 Polyclonal antibody

CATALOG NUMBER: 14560-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DHRS9 (14560-1-AP) by Proteintech is a Polyclonal antibody targeting DHRS9 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14560-1-AP targets DHRS9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, mouse trachea tissue, HT-29 cells, THP-1 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Dehydrogenase/reductase 9(DHRS9), is a member of the short-chain dehydrogenases/reductases (SDR) family. DHRS9 has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. DHRS9 has 4 isoforms with molecular weight of 19, 30, 35, 42 kDa, and demonstrates oxidoreductase activity toward hydroxysteroids. DHRS9 is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6116 Product name: Recombinant human DHRS9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-319 aa of BC058883 Sequence: MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV Predict reactive species Full Name: dehydrogenase/reductase (SDR family) member 9 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC058883 Gene Symbol: DHRS9 Gene ID (NCBI): 10170 RRID: AB_2277277 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BPW9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924