Proteintech, 14571-1-AP, TMEM27 Polyclonal antibody

Size: 20ul / 150ul The TMEM27 (14571-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM27 in WB, ELISA applications with reactivity to human, mouse, rat samples 14571-1-AP targets TMEM27 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, human spleen tissue, MCF-7 cells, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TMEM27 (also termed collectrin), a 46 kDa type I transmembrane protein, is a homolog of the noncatalytic domain of angiotensin-converting enzyme-related carboxypeptidase (Ace2). Its expression has only been reported in the brush border membrane of the proximal tubules and collecting ducts of the kidney and in the pancreatic b cell (PMID: 11278314, 16330324). Overexpression of TMEM27 in b cells leads to increased proliferation in vitro and increased pancreatic b cell mass in vivo, and also has been reported to augment glucosestimulated INS secretion (GSIS) (PMID: 16330324, 16330323). The abundance of TMEM27 protein in b cells is furthermore regulated by ectodomain cleavage, which leads to two cleavage products, a 25 kDa N-terminal part that is released into the extracellular space (the shed fragment), and a 22 kDa C-terminal fragment (CTF) remaining in the membrane that is rapidly degraded (PMID: 16330324). TMEM27 is an N-glycosylated protein and can form dimers with MW of 64-75 kDa(patent US 20100119489 A1). TMEM27 can be used as a beta cell mass biomarker (PMID: 20386877, 21907142). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6187 Product name: Recombinant human TMEM27 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 27-143 aa of BC050606 Sequence: VRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSVPIW Predict reactive species Full Name: transmembrane protein 27 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC050606 Gene Symbol: TMEM27 Gene ID (NCBI): 57393 RRID: AB_2204913 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HBJ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.