Proteintech, 14580-1-AP, Perforin Polyclonal antibody

Size: 20ul / 150ul The Perforin (14580-1-AP) by Proteintech is a Polyclonal antibody targeting Perforin in WB, ELISA applications with reactivity to human samples 14580-1-AP targets Perforin in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: CTLL-2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Perforin 1 (PRF1) is one of the major cytolytic proteins of cytolytic granules. It is known to be a crucial effector molecule in cytolytic T lymphocyte and natural killer cell-mediated cytotoxicity. This protein has structural and functional similarities to complement component C9. Like C9, this protein creates transmembrane tubules and is capable of lysing nonspecifically a variety of target cells. Defects in PRF1 are the cause of familial hemophagocytic lymphohistiocytosis type 2 (FHL2), which is characterized by immune dysregulation with hypercytokinemia and defective natural killer cell function. (PMID: 2417226; 7774276; 2783486; 10583959) Specification Tested Reactivity: human Cited Reactivity: human, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6060 Product name: Recombinant human Perforin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 247-555 aa of BC063043 Sequence: EGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERHSEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVTFIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW Predict reactive species Full Name: perforin 1 (pore forming protein) Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC063043 Gene Symbol: Perforin Gene ID (NCBI): 5551 RRID: AB_10639524 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14222 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.