Proteintech, 14588-1-AP, NRARP Polyclonal antibody

Size: 20ul / 150ul The NRARP (14588-1-AP) by Proteintech is a Polyclonal antibody targeting NRARP in IHC, IF/ICC, ELISA applications with reactivity to human samples 14588-1-AP targets NRARP in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NRARP, Notch-regulated ankyrin repeat-containing protein, acts as a downstream effector of Notch signaling, involved in angiogenesis acting downstream of Notch at branch points to regulate vascular density. NRARP is also involved in the regulation of liver cancer cells self-renewal (PMID: 25985737, PMID: 19154719). During somitogenesis, it is involved in maintenance of proper somite segmentation and proper numbers of somites and vertebrae. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6114 Product name: Recombinant human NRARP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC053618 Sequence: MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR Predict reactive species Full Name: NOTCH-regulated ankyrin repeat protein Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC053618 Gene Symbol: NRARP Gene ID (NCBI): 441478 RRID: AB_3085438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z6K4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.