Iright
BRAND / VENDOR: Proteintech

Proteintech, 14614-1-AP, ST3GAL5 Polyclonal antibody

CATALOG NUMBER: 14614-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ST3GAL5 (14614-1-AP) by Proteintech is a Polyclonal antibody targeting ST3GAL5 in WB, IHC, ELISA applications with reactivity to human, mouse samples 14614-1-AP targets ST3GAL5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, HeLa cells, human testis tissue, human placenta tissue Positive IHC detected in: mouse skeletal muscle tissue, human skeletal muscle tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ST3GAL5 is also named as SIAT9, GM3 synthase, ST3Gal V, Sialyltransferase 9 and belongs to the glycosyltransferase 29 family. ST3GAL5 transfers the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc to the non-reducing terminal galactose of glycosphingolipids forming gangliosides (PMID:9822625, PMID:16934889). SIAT9 is mainly involved in the biosynthesis of ganglioside GM3 but can also use different glycolipids as substrate acceptors such as D-galactosylceramide (GalCer), asialo-GM2 (GA2) and asialo-GM1 (GA1) (PMID:16934889). ST3GAL5 is highly expressed in brain, skeletal muscle, placenta, and testis. And mRNA of ST3GAL5 is widely distributed in human brain, but slightly elevated expression was observed in the cerebral cortex, temporal lobe, and putamen (PMID:9822625). ST3GAL5 has 3 isoforms with the molecular mass of 45, 46, and 48 kDa. Sometimes the band of 70 kDa can also be observed, which may be a glycosylated form of ST3GAL5 (PMID: 34943806, PMID: 26458842). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6207 Product name: Recombinant human ST3GAL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 88-418 aa of BC065936 Sequence: TTEECDMKKMHYVDPDRVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDSQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF Predict reactive species Full Name: ST3 beta-galactoside alpha-2,3-sialyltransferase 5 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC065936 Gene Symbol: ST3GAL5 Gene ID (NCBI): 8869 RRID: AB_2194414 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNP4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924