Proteintech, 14619-1-AP, NMUR1 Polyclonal antibody

Size: 20ul / 150ul The NMUR1 (14619-1-AP) by Proteintech is a Polyclonal antibody targeting NMUR1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 14619-1-AP targets NMUR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human colon tissue, human stomach tissue, mouse pancreas tissue Positive IHC detected in: mouse brain tissue, human colon tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Neuromedin-U (NMU) is a widely expressed peptide with the highest abundance in the central nervous system (CNS) and intestinal tract of nearly all vertebrate species. NMU mediates several physiological functions via its two cognate receptors, NMUR1 and NMUR2 (PMID:37102164). NMUR1(NmU receptor 1) has the highest expression in peripheral tissues, particularly the GI tract, pancreas, uterus, and testes but has also been reported in peripheral nerve terminals (PMID:10783389). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6235 Product name: Recombinant human NMUR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-426 aa of BC036543 Sequence: YEMWHNYPFLLGVGGCYFRTLLFEMVCLASVLNVTALSVERYVAVVHPLQARSMVTRAHVRRVLGAVWGLAMLCSLPNTSLHGIQQLHVPCRGPVPDSAVCMLVRPRALYNMVVQTTALLFFCLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLFVLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSAANPVLYSLMSSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS Predict reactive species Full Name: neuromedin U receptor 1 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC036543 Gene Symbol: NMUR1 Gene ID (NCBI): 10316 RRID: AB_2267310 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HB89 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.