Proteintech, 14661-1-AP, PHLDA2 Polyclonal antibody

Size: 20ul / 150ul The PHLDA2 (14661-1-AP) by Proteintech is a Polyclonal antibody targeting PHLDA2 in WB, IHC, ELISA applications with reactivity to human samples 14661-1-AP targets PHLDA2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, human placenta tissue, MCF-7 cells, PC-3 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6331 Product name: Recombinant human PHLDA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC005034 Sequence: MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP Predict reactive species Full Name: pleckstrin homology-like domain, family A, member 2 Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC005034 Gene Symbol: PHLDA2 Gene ID (NCBI): 7262 RRID: AB_2163294 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53GA4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.