Iright
BRAND / VENDOR: Proteintech

Proteintech, 14687-1-AP, SLC44A1 Polyclonal antibody

CATALOG NUMBER: 14687-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC44A1 (14687-1-AP) by Proteintech is a Polyclonal antibody targeting SLC44A1 in WB, IHC, ELISA applications with reactivity to human samples 14687-1-AP targets SLC44A1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: 37°C incubated HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SLC44A1, also referred to as choline transporter-like protein 1 (CTL1) or CDw92, is a choline transporter detected in both the plasma and mitochondrial membranes where it transports choline at high affinity and in a Na+-independent manner. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6024 Product name: Recombinant human SLC44A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 55-208 aa of BC049203 Sequence: AARLVSGYDSYGNICGQKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISCYAKFAEALITFVSDNSVLHRLISGV Predict reactive species Full Name: solute carrier family 44, member 1 Calculated Molecular Weight: 73 kDa Observed Molecular Weight: 70-73 kDa GenBank Accession Number: BC049203 Gene Symbol: SLC44A1 Gene ID (NCBI): 23446 RRID: AB_10640573 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWI5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924