Proteintech, 14694-1-AP, AMN1 Polyclonal antibody

Size: 20ul / 150ul The AMN1 (14694-1-AP) by Proteintech is a Polyclonal antibody targeting AMN1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14694-1-AP targets AMN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human colon tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information AMN1, also known as the antagonist of mitotic exit network 1 homolog, is a protein-coding gene that plays a significant role in regulating cell division and mitotic exit in Saccharomyces cerevisiae (baker's yeast). AMN1 is an atypical F-box protein involved in the regulation of the MEN pathway. It acts as an antagonist by disrupting the formation of the Tem1/Cdc15 complex, which is crucial for mitotic exit. Specifically, AMN1 competes with Cdc15 for binding to Tem1, thereby turning off the MEN pathway. AMN1 is essential for cell separation after cytokinesis. It inhibits the transcription factor Ace2, leading to the downregulation of Ace2 target genes. This inhibition prevents septum cleavage and results in post-mitotic cell separation inhibition, causing cell clumping. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6257 Product name: Recombinant human AMN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC067906 Sequence: MQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY Predict reactive species Full Name: antagonist of mitotic exit network 1 homolog (S. cerevisiae) Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC067906 Gene Symbol: AMN1 Gene ID (NCBI): 196394 RRID: AB_2226647 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IY45 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.