Proteintech, 14697-1-AP, KCNAB1 Polyclonal antibody

Size: 20ul / 150ul The KCNAB1 (14697-1-AP) by Proteintech is a Polyclonal antibody targeting KCNAB1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14697-1-AP targets KCNAB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, Neuro-2a cells Positive IHC detected in: human brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:300-1:1500 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6339 Product name: Recombinant human KCNAB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 82-401 aa of BC043166 Sequence: RVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS Predict reactive species Full Name: potassium voltage-gated channel, shaker-related subfamily, beta member 1 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC043166 Gene Symbol: KCNAB1 Gene ID (NCBI): 7881 RRID: AB_2131349 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14722 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.