Product Description
Size: 20ul / 150ul
The PCP4 (14705-1-AP) by Proteintech is a Polyclonal antibody targeting PCP4 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples
14705-1-AP targets PCP4 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain
Positive IP detected in: mouse brain tissue
Positive IHC detected in: human cerebellum tissue, mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse cerebellum tissue, mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Background Information
PCP4, also named as PEP19, belongs to a family of proteins involved in calcium transduction signals and binds calmodulin via an IQ motif, in a calcium independent manner. It is mainly expressed in ectoderm and neuroectoderm comprising neural crest derived cells.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag6388 Product name: Recombinant human PCP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC013791 Sequence: MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS Predict reactive species
Full Name: Purkinje cell protein 4
Calculated Molecular Weight: 7 kDa
Observed Molecular Weight: 8 kDa
GenBank Accession Number: BC013791
Gene Symbol: PCP4
Gene ID (NCBI): 5121
RRID: AB_2878075
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P48539
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924