Iright
BRAND / VENDOR: Proteintech

Proteintech, 14705-1-AP, PCP4 Polyclonal antibody

CATALOG NUMBER: 14705-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PCP4 (14705-1-AP) by Proteintech is a Polyclonal antibody targeting PCP4 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 14705-1-AP targets PCP4 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain Positive IP detected in: mouse brain tissue Positive IHC detected in: human cerebellum tissue, mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information PCP4, also named as PEP19, belongs to a family of proteins involved in calcium transduction signals and binds calmodulin via an IQ motif, in a calcium independent manner. It is mainly expressed in ectoderm and neuroectoderm comprising neural crest derived cells. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6388 Product name: Recombinant human PCP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC013791 Sequence: MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS Predict reactive species Full Name: Purkinje cell protein 4 Calculated Molecular Weight: 7 kDa Observed Molecular Weight: 8 kDa GenBank Accession Number: BC013791 Gene Symbol: PCP4 Gene ID (NCBI): 5121 RRID: AB_2878075 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48539 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924