Proteintech, 14710-1-AP, MORF4L2 Polyclonal antibody

Size: 20ul / 150ul The MORF4L2 (14710-1-AP) by Proteintech is a Polyclonal antibody targeting MORF4L2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14710-1-AP targets MORF4L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human liver tissue, mouse liver tissue, A431 cells, A549 cells, MCF-7 cells Positive IF/ICC detected in: MCF-7 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6404 Product name: Recombinant human MORF4L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-288 aa of BC056899 Sequence: MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL Predict reactive species Full Name: mortality factor 4 like 2 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 30-32 kDa GenBank Accession Number: BC056899 Gene Symbol: MORF4L2 Gene ID (NCBI): 9643 RRID: AB_2297880 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15014 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.