Proteintech, 14718-1-AP, PGD Polyclonal antibody

Size: 20ul / 150ul The PGD (14718-1-AP) by Proteintech is a Polyclonal antibody targeting PGD in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14718-1-AP targets PGD in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, mouse liver tissue, rat liver tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human liver cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PGD, also named as PGDH, belongs to the 6-phosphogluconate dehydrogenase family. PGD catalyses the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate in the context of the oxidative part of the pentose phosphate pathway. PGD is important for the production of NADPH, which is necessary for reductive biosynthesis, such as the formation of lipids and nucleotides, and the activity of enzymes involved in maintaining cell integrity, in combatting oxidative stress and in the first line of immunological defence. (PMID: 35234135) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6444 Product name: Recombinant human PGD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 137-483 aa of BC000368 Sequence: YGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA Predict reactive species Full Name: phosphogluconate dehydrogenase Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 53 kDa, 45 kDa GenBank Accession Number: BC000368 Gene Symbol: PGD Gene ID (NCBI): 5226 RRID: AB_2236801 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52209 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.