Proteintech, 14732-1-AP, hD53; TPD52L1 Polyclonal antibody

Size: 20ul / 150ul The hD53; TPD52L1 (14732-1-AP) by Proteintech is a Polyclonal antibody targeting hD53; TPD52L1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 14732-1-AP targets hD53; TPD52L1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF7 cells, MCF-7 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human colon cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Tumor protein D52-like 1 (TPD52L1) gene, also known as hD53, encodes a member of the tumor protein D52 (TPD52) family. TPD52-like proteins are coiled-coil motif-bearing proteins first identified through their expression in human breast carcinoma, which have been proposed to represent signaling intermediates and regulators of vesicle trafficking. hD53 may form homo- or heterodimers with other TPD52 family members, and it is reported to be involved in cell proliferation and calcium signaling. Four variants resulted from alternative splicing have been predicated and this antibody is expected to recognize all the variants. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6493 Product name: Recombinant human hD53; TPD52L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC002375 Sequence: MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRRK Predict reactive species Full Name: tumor protein D52-like 1 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC002375 Gene Symbol: TPD52L1 Gene ID (NCBI): 7164 RRID: AB_2272159 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16890 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.