Proteintech, 14749-1-AP, CORO1C Polyclonal antibody

Size: 20ul / 150ul The CORO1C (14749-1-AP) by Proteintech is a Polyclonal antibody targeting CORO1C in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14749-1-AP targets CORO1C in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, human heart tissue, SGC-7901 cells, HeLa cells, mouse skeletal muscle tissue Positive IP detected in: mouse heart tissue, mouse skeletal muscle tissue Positive IHC detected in: human cervical cancer tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CORO1C also known as HCRNN4, belongs to the WD repeat coronin family. CORO1C contains 5 N-terminal trp-asp (WD) repeats and a C-terminal coiled-coil motif. It was reported to regulate actin‐dependent processes by assembling F-actin. CORO1C promoted the invasion of breast cancer and glioma cells by specifically promoting the formation of invadopodia(PMID: 30974047). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6488 Product name: Recombinant human CORO1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-306 aa of BC002342 Sequence: MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLN Predict reactive species Full Name: coronin, actin binding protein, 1C Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC002342 Gene Symbol: CORO1C Gene ID (NCBI): 23603 RRID: AB_2230110 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.