Proteintech, 14767-1-AP, PWP1 Polyclonal antibody

Size: 20ul / 150ul The PWP1 (14767-1-AP) by Proteintech is a Polyclonal antibody targeting PWP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 14767-1-AP targets PWP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, human liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6533 Product name: Recombinant human PWP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 154-501 aa of BC001652 Sequence: CGRAEQDQCNLDVHVYNQEEDSFYVHHDILLSAYPLSVEWLNFDPSPDDSTGNYIAVGNMTPVIEVWDLDIVDSLEPVFTLGSKLSKKKKKKGKKSSSAEGHTDAVLDLSWNKLIRNVLASASADNTVILWDMSLGKPAASLAVHTDKVQTLQFHPFEAQTLISGSYDKSVALYDCRSPDESHRMWRFSGQIERVTWNHFSPCHFLASTDDGFVYNLDARSDKPIFTLNAHNDEISGLDLSSQIKGCLVTASADKYVKIWDILGDRPSLVHSRDMKMGVLFCSSCCPDLPFIYALRGQKEGLRVWDISTVSSVNEAFGRRERLVLGSARNSSISGPFGSRSSDTPMES Predict reactive species Full Name: PWP1 homolog (S. cerevisiae) Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 50-56 kDa GenBank Accession Number: BC001652 Gene Symbol: PWP1 Gene ID (NCBI): 11137 RRID: AB_2174294 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13610 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.