Proteintech, 14778-1-AP, AIFM3 Polyclonal antibody

Size: 20ul / 150ul The AIFM3 (14778-1-AP) by Proteintech is a Polyclonal antibody targeting AIFM3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14778-1-AP targets AIFM3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, U-87 MG cells Positive IHC detected in: human ovary tumor tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Apoptosis-inducing factor, mitochondrion-associated 3 (AIFM3) is a mitochondrial protein/flavoenzyme and its gene is located on chromosome 22q11.21. Mature human AIFM3 protein consists of 598 amino acids with a molecular weight of 66 kDa and is predominantly localized in the mitochondria. AIFM3 is widely expressed in many tissues, and breast cancer tissues and cholangiocarcinoma tissue (PMID: 32664187). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6278 Product name: Recombinant human AIFM3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 355-598 aa of BC032485 Sequence: AHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS Predict reactive species Full Name: apoptosis-inducing factor, mitochondrion-associated, 3 Calculated Molecular Weight: 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC032485 Gene Symbol: AIFM3 Gene ID (NCBI): 150209 RRID: AB_2258090 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96NN9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.