Proteintech, 14798-1-AP, BAT1 Polyclonal antibody

Size: 20ul / 150ul The BAT1 (14798-1-AP) by Proteintech is a Polyclonal antibody targeting BAT1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 14798-1-AP targets BAT1 in WB, IHC, IF, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, rat spleen tissue Positive IP detected in: Jurkat cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BAT1, is a 428 amino acid protein, which contains one helicase C-terminal domain, one helicase ATP-binding domain and belongs to the DEAD box helicase family. DECD subfamily. DDX39B localizes in the nucleus and cytoplasm. BAT1 is involved in nuclear export of spliced and unspliced mRNA. BAT1 as ATP dependent RNA helicase, may be a translation initiation factor and acts as a negative regulator of inflammatory cytokines. This antibody may cross-react with DDX39A. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6512 Product name: Recombinant human BAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 80-428 aa of BC000361 Sequence: ILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR Predict reactive species Full Name: HLA-B associated transcript 1 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC000361 Gene Symbol: BAT1 Gene ID (NCBI): 7919 RRID: AB_2061854 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13838 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.