Proteintech, 14858-1-AP, SYK Polyclonal antibody

Size: 20ul / 150ul The SYK (14858-1-AP) by Proteintech is a Polyclonal antibody targeting SYK in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 14858-1-AP targets SYK in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Daudi cells, Raji cells, Ramos cells Positive IHC detected in: human liver cancer tissue, human appendicitis tissue, human spleen tissue, human kidney tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: Ramos cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SYK belongs to the protein kinase superfamily, Tyr protein kinase family and SYK/ZAP-70 subfamily. It is positive effector of BCR-stimulated responses. SYK couples the B-cell antigen receptor (BCR) to the mobilization of calcium ion either through a phosphoinositide 3-kinase-dependent pathway, when not phosphorylated on tyrosines of the linker region, or through a phospholipase C-gamma-dependent pathway It phosphorylates USP25 and regulates its intracellular levels. SYK also promotes liver fibrosis by activation of hepatic stellate cells and acts as a biomarker for human hepatocellular carcinoma. (PMID: 29537660) SYK can be detected 66-72 kDa in human and mouse (PMID: 37661351). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6657 Product name: Recombinant human SYK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 368-635 aa of BC001645 Sequence: KLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN Predict reactive species Full Name: spleen tyrosine kinase Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 66-72 kDa GenBank Accession Number: BC001645 Gene Symbol: SYK Gene ID (NCBI): 6850 ENSEMBL Gene ID: ENSG00000165025 RRID: AB_2878086 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43405 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.